PDB entry 6c5y

View 6c5y on RCSB PDB site
Description: Crystal structure of thaumatin from microcrystals
Class: plant protein
Keywords: microcrystal, microdiffraction, data analysis, PLANT PROTEIN
Deposited on 2018-01-17, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-1
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c5ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c5yA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta