PDB entry 6c5q

View 6c5q on RCSB PDB site
Description: PPARg LBD bound to SR10171
Class: transcription
Keywords: peroxisome proliferator activated receptor gamma, PPARG, nuclear receptor, inverse agonist, TRANSCRIPTION
Deposited on 2018-01-16, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (10-280)
      • expression tag (3-9)
    Domains in SCOPe 2.07: d6c5qa1, d6c5qa2
  • Heterogens: EKS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c5qA (A:)
    hhhhhhgshmesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslm
    mgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvt
    llkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfna
    lelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakll
    qkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c5qA (A:)
    hhhgshmesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly