PDB entry 6c5n

View 6c5n on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
Class: oxidoreductase
Keywords: ketol-acid reductoisomerase, isomerase, inhibitor, OXIDOREDUCTASE
Deposited on 2018-01-16, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: ilvC, SAB1941
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c5na1, d6c5na2
  • Chain 'B':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: ilvC, SAB1941
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c5nb1, d6c5nb2
  • Heterogens: NDP, MG, EN4, 81B, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c5nA (A:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelremmpfiksksiekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c5nA (A:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelremmpfi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c5nB (B:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelremmpfiksksiekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c5nB (B:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelremmpfi