PDB entry 6c4s

View 6c4s on RCSB PDB site
Description: Human cSrc SH3 Domain in complex with Choline Kinase fragment 60-69
Class: transferase, peptide binding protein
Keywords: enzyme, non-receptor tyrosine kinase, PEPTIDE BINDING PROTEIN, TRANSFERASE
Deposited on 2018-01-12, released 2019-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src,cSrc SH3 Domain
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (2-59)
      • expression tag (0-1)
    • PDB 6C4S (60-73)
    Domains in SCOPe 2.08: d6c4sa1, d6c4sa2
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src,cSrc SH3 Domain
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (2-59)
      • expression tag (0-1)
    • PDB 6C4S (60-73)
    Domains in SCOPe 2.08: d6c4sb1, d6c4sb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c4sA (A:)
    hmttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    ggglppplplplpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c4sB (B:)
    hmttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    ggglppplplplpl