PDB entry 6c46

View 6c46 on RCSB PDB site
Description: Crystal structure of dTDP-4-dehydrorhamnose 3,5-epimerase from Elizabethkingia anophelis NUHP1
Class: isomerase
Keywords: SSGCID, Structural Genomics, Elizabethkingia anophelis, dTDP-4-dehydrorhamnose 3, 5-epimerase, BD94_3275, Seattle Structural Genomics Center for Infectious Disease, ISOMERASE
Deposited on 2018-01-11, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
    Gene: BD94_3275
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c46a1, d6c46a2
  • Chain 'B':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
    Gene: BD94_3275
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c46b1, d6c46b2
  • Chain 'C':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
    Gene: BD94_3275
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c46c1, d6c46c2
  • Chain 'D':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
    Gene: BD94_3275
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c46d1, d6c46d2
  • Chain 'E':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
    Gene: BD94_3275
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c46e1, d6c46e2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c46A (A:)
    mahhhhhhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdnisk
    ssygvlrglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfy
    vprgfahgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqn
    apafkdkny
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c46A (A:)
    hhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdniskssygvl
    rglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfyvprgfa
    hgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqnapafkd
    kny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c46B (B:)
    mahhhhhhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdnisk
    ssygvlrglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfy
    vprgfahgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqn
    apafkdkny
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c46B (B:)
    hhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdniskssygvl
    rglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfyvprgfa
    hgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqnapafkd
    kny
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c46C (C:)
    mahhhhhhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdnisk
    ssygvlrglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfy
    vprgfahgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqn
    apafkdkny
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c46C (C:)
    hhmklvktplkdcyiieptvfedrgyfyekynekkfeeltglnghfvqdniskssygvlr
    glhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfyvprgfah
    gfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqnapafkdk
    ny
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c46D (D:)
    mahhhhhhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdnisk
    ssygvlrglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfy
    vprgfahgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqn
    apafkdkny
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c46D (D:)
    hhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdniskssygvl
    rglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfyvprgfa
    hgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqnapafkd
    kny
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6c46E (E:)
    mahhhhhhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdnisk
    ssygvlrglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfy
    vprgfahgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqn
    apafkdkny
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c46E (E:)
    hhmklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdniskssygvl
    rglhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfyvprgfa
    hgfvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqnapafkd
    kny