PDB entry 6c45

View 6c45 on RCSB PDB site
Description: Crystal structure of human inorganic pyrophosphatase in the P212121 space group
Class: hydrolase
Keywords: inorganic pyrophosphatase (PPase) family, hydrolysis of pyrophosphate to inorganic phosphate, HYDROLASE
Deposited on 2018-01-11, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: PPA1, IOPPP, PP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c45a_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: PPA1, IOPPP, PP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c45b_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: PPA1, IOPPP, PP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c45c_
  • Chain 'D':
    Compound: inorganic pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: PPA1, IOPPP, PP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c45d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c45A (A:)
    msgfsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmei
    atkdplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpi
    dvceigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkp
    gyleatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgi
    scmnttlsespfkcdpdaaraivdalpppcesactvptdvdkwfhhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c45A (A:)
    gfsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmeiat
    kdplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpidv
    ceigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkpgy
    leatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgisc
    mnttlsespfkcdpdaaraivdalpppcesactvptdvdkwfhhqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c45B (B:)
    msgfsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmei
    atkdplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpi
    dvceigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkp
    gyleatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgi
    scmnttlsespfkcdpdaaraivdalpppcesactvptdvdkwfhhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c45B (B:)
    fsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmeiatk
    dplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpidvc
    eigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkpgyl
    eatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgiscm
    nttlsespfkcdpdaaraivdalpppcesactvptdvdkwfh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c45C (C:)
    msgfsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmei
    atkdplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpi
    dvceigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkp
    gyleatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgi
    scmnttlsespfkcdpdaaraivdalpppcesactvptdvdkwfhhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c45C (C:)
    gfsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmeiat
    kdplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpidv
    ceigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkpgy
    leatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgisc
    mnttlsespfkcdpdaaraivdalpppcesactvptdvdkwfhhq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c45D (D:)
    msgfsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmei
    atkdplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpi
    dvceigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkp
    gyleatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgi
    scmnttlsespfkcdpdaaraivdalpppcesactvptdvdkwfhhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c45D (D:)
    fsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmeiatk
    dplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpidvc
    eigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkpgyl
    eatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgiscm
    nttlsespfkcdpdaaraivdalpppcesactvptdvdkwfh