PDB entry 6c42

View 6c42 on RCSB PDB site
Description: Estrogen Receptor Alpha Ligand Binding Domain in Complex with OP1156
Class: trascription/transcription inhibitor
Keywords: Estrogen Receptor Alpha, Antiestrogen, Selective Estrogen Receptor Degrader, Endocrine Therapy, Steroid Receptor, Nuclear Hormone Receptor, Breast Cancer, Acquired Antiestrogen Resistance, TRANSCRIPTION, trascription-transcription inhibitor complex
Deposited on 2018-01-11, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (75)
      • engineered mutation (111)
      • engineered mutation (224)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d6c42a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (75)
      • engineered mutation (224)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d6c42b_
  • Heterogens: 85M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c42A (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c42A (A:)
    tadqmvsalldaeppilyseydppfseasmmglltnladrelvhminwakrvpgfvdltl
    hdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakag
    ltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c42B (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c42B (B:)
    lalsltadqmvsalldaeppilyseydppfsmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgkegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvyeekdhihrvldkitdtlihlmakagltlqqqhq
    rlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldah