PDB entry 6c3z

View 6c3z on RCSB PDB site
Description: T477A SiRHP
Class: metal binding protein
Keywords: redox, iron-sulfur cluster, Fe4-S4 cluster, siroheme, iron, METAL BINDING PROTEIN
Deposited on 2018-01-11, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfite reductase [NADPH] hemoprotein beta-component
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: cysI, b2763, JW2733
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17846 (Start-569)
      • engineered mutation (476)
    Domains in SCOPe 2.07: d6c3za1, d6c3za2, d6c3za3, d6c3za4
  • Heterogens: PO4, K, SF4, SRM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c3zA (A:)
    msekhpgplvvegkltdaermkhesnylrgtiaedlndgltggfkgdnfllirfhgmyqq
    ddrdiraeraeqkleprhamllrcrlpggvittkqwqaidkfagentiygsirltnrqtf
    qfhgilkknvkpvhqmlhsvgldalatandmnrnvlctsnpyesqlhaeayewakkiseh
    llprtrayaeiwldqekvattdeepilgqtylprkfkttvvippqndidlhandmnfvai
    aengklvgfnllvggglsiehgnkktyartasefgylplehtlavaeavvttqrdwgnrt
    drknaktkytlervgvetfkaeverragikfepirpyeftgrgdrigwvkgiddnwhltl
    fiengrildyparplktglleiakihkgdfritanqnliiagvpesekakiekiakesgl
    mnavtpqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvagcp
    ngcgramlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwak
    ereagegfgdftvragiirpvldpardlwd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3zA (A:)
    lrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsvg
    ldalatndmnrnvlctsnpyesqlhaeayewakkisehllptylprkfkttvvippqndi
    dlhandmnfvaiaengklvgfnllvggglsiehgnkktyartasefgylplehtlavaea
    vvttqrdwgnrtdrknaktkytlervgvetfkaeverragikfepirpyeftgrgdrigw
    vkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpesek
    akiekiakesglmnavtpqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvs
    dehivmrvagcpngcgramlaevglvgkapgrynlhlggnrigtriprmykenitepeil
    asldeligrwakereagegfgdftvragiirpvldpardlwd