PDB entry 6c3y

View 6c3y on RCSB PDB site
Description: Wild type structure of SiRHP
Class: metal binding protein
Keywords: redox, iron-sulfur cluster, Fe4-S4 cluster, siroheme, iron, METAL BINDING PROTEIN
Deposited on 2018-01-11, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfite reductase [NADPH] hemoprotein beta-component
    Species: Escherichia coli [TaxId:83333]
    Gene: cysI, b2763, JW2733
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17846 (Start-569)
      • engineered mutation (443)
    Domains in SCOPe 2.08: d6c3ya1, d6c3ya2, d6c3ya3, d6c3ya4
  • Heterogens: PO4, K, SF4, SRM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c3yA (A:)
    msekhpgplvvegkltdaermkhesnylrgtiaedlndgltggfkgdnfllirfhgmyqq
    ddrdiraeraeqkleprhamllrcrlpggvittkqwqaidkfagentiygsirltnrqtf
    qfhgilkknvkpvhqmlhsvgldalatandmnrnvlctsnpyesqlhaeayewakkiseh
    llprtrayaeiwldqekvattdeepilgqtylprkfkttvvippqndidlhandmnfvai
    aengklvgfnllvggglsiehgnkktyartasefgylplehtlavaeavvttqrdwgnrt
    drknaktkytlervgvetfkaeverragikfepirpyeftgrgdrigwvkgiddnwhltl
    fiengrildyparplktglleiakihkgdfritanqnliiagvpesekakiekiakesgl
    mnavtpqrensmacvsfptcplaaaeaerflpsfidnidnlmakhgvsdehivmrvtgcp
    ngcgramlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwak
    ereagegfgdftvragiirpvldpardlwd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3yA (A:)
    llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsv
    gldalatandmnrnvlctsnpyesqlhaeayewakkisehllptylprkfkttvvippqn
    didlhandmnfvaiaengklvgfnllvggglsiehgnkktyartasefgylplehtlava
    eavvttqrdwgnrtdrknaktkytlervgvetfkaeverragikfepirpyeftgrgdri
    gwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpes
    ekakiekiakesglmnavtpqrensmacvsfptcplaaaeaerflpsfidnidnlmakhg
    vsdehivmrvtgcpngcgramlaevglvgkapgrynlhlggnrigtriprmykenitepe
    ilasldeligrwakereagegfgdftvragiirpvldpardlwd