PDB entry 6c3u

View 6c3u on RCSB PDB site
Description: Crystal structure of Klebsiella pneumoniae fosfomycin resistance protein (FosAKP) with inhibitor (ANY2) bound
Class: transferase/inhibitor
Keywords: fosfomycin, FosA, FosAKP, glutathione S-transferase, ANY2, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2018-01-10, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FosA family fosfomycin resistance glutathione transferase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: AGG09_10885, B8011_01255, BL102_0004085, CEO55_05040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c3ua_
  • Chain 'B':
    Compound: FosA family fosfomycin resistance glutathione transferase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: AGG09_10885, B8011_01255, BL102_0004085, CEO55_05040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c3ub_
  • Chain 'C':
    Compound: FosA family fosfomycin resistance glutathione transferase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: AGG09_10885, B8011_01255, BL102_0004085, CEO55_05040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c3uc_
  • Chain 'D':
    Compound: FosA family fosfomycin resistance glutathione transferase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: AGG09_10885, B8011_01255, BL102_0004085, CEO55_05040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c3ud_
  • Heterogens: NY2, MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c3uA (A:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffeqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3uA (A:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c3uB (B:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffeqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3uB (B:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c3uC (C:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffeqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3uC (C:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c3uD (D:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffeqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3uD (D:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvff