PDB entry 6c3l

View 6c3l on RCSB PDB site
Description: Crystal structure of BCL6 BTB domain with compound 15f
Class: protein binding/inhibitor
Keywords: Inhibitor, protein-protein interaction, PROTEIN BINDING, protein binding-inhibitor complex
Deposited on 2018-01-10, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (6-End)
      • engineered mutation (9)
      • engineered mutation (68)
      • engineered mutation (85)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6c3la_
  • Chain 'B':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (6-End)
      • engineered mutation (9)
      • engineered mutation (68)
      • engineered mutation (85)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6c3lb_
  • Heterogens: EGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c3lA (A:)
    gsmaspadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfy
    siftdqlkrnlsvinldpeinpegfnilldfmytsrlnlrvgnimavmatamylqmehvv
    dtcrkfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3lA (A:)
    adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
    lkrnlsvinldpeinpegfnilldfmytsrlnlrvgnimavmatamylqmehvvdtcrkf
    ikas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c3lB (B:)
    gsmaspadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfy
    siftdqlkrnlsvinldpeinpegfnilldfmytsrlnlrvgnimavmatamylqmehvv
    dtcrkfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3lB (B:)
    adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
    lkrnlsvinldpeinpegfnilldfmytsrlnlrvgnimavmatamylqmehvvdtcrkf
    ikas