PDB entry 6c3e

View 6c3e on RCSB PDB site
Description: crystal structure of rip1 kinase bound to inhibitor
Class: Transferase/Transferase Inhibitor
Keywords: HUMAN RIP1 KINASE, CELL CYCLE, Transferase-Transferase Inhibitor complex
Deposited on 2018-01-09, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-interacting serine/threonine-protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RIPK1, RIP, RIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13546
      • conflict (36)
      • conflict (129)
      • conflict (235)
      • conflict (242)
      • conflict (254)
    Domains in SCOPe 2.07: d6c3ea_
  • Chain 'B':
    Compound: Receptor-interacting serine/threonine-protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RIPK1, RIP, RIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13546 (Start-296)
      • conflict (36)
      • conflict (129)
      • conflict (235)
      • conflict (242)
      • conflict (254)
    Domains in SCOPe 2.07: d6c3eb_
  • Heterogens: EJY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c3eA (A:)
    ggsgqpdmslnvikmkssdflesaeldsggfgkvslafhrtqglmimktvykgpnciehn
    ealleeakmmnrlrhsrvvkllgviieegkyslvmeymekgnlmhvlkaemstplsvkgr
    iileiiegmaylhgkgvihkdlkpenilvdndfhikiadlglasfkmwsklnneehnelr
    evdgtakknggtlyymapehlndvnakpteksdvysfavvlwaifankepyenaiaeqql
    imaiksgnrpdvddlteycpreiislmklcweanpearptfpgieekfrpfylsqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3eA (A:)
    vikmkssdflesaeldsggfgkvslafhrtqglmimktvykiehnealleeakmmnrlrh
    srvvkllgviieegkyslvmeymekgnlmhvlkaemstplsvkgriileiiegmaylhgk
    gvihkdlkpenilvdndfhikiadlglasfkmwsklnngtlyymapehlpteksdvysfa
    vvlwaifankepyenaiaeqqlimaiksgnrpdvddlteycpreiislmklcweanpear
    ptfpgieekfrpfylsql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c3eB (B:)
    ggsgqpdmslnvikmkssdflesaeldsggfgkvslafhrtqglmimktvykgpnciehn
    ealleeakmmnrlrhsrvvkllgviieegkyslvmeymekgnlmhvlkaemstplsvkgr
    iileiiegmaylhgkgvihkdlkpenilvdndfhikiadlglasfkmwsklnneehnelr
    evdgtakknggtlyymapehlndvnakpteksdvysfavvlwaifankepyenaiaeqql
    imaiksgnrpdvddlteycpreiislmklcweanpearptfpgieekfrpfylsqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c3eB (B:)
    ikmkssdflesaekvslafhrtqglmimktvykgpnciehnealleeakmmnrlrhsrvv
    kllgviieegkyslvmeymekgnlmhvlkaemstplsvkgriileiiegmaylhgkgvih
    kdlkpenilvdndfhikiadlglasfkmwsklgtlyymapehlndvnakpteksdvysfa
    vvlwaifankepyenaiaeqqlimaiksgnrpdvddlteycpreiislmklcweanpear
    ptfpgieekfrpfylsqle