PDB entry 6c39

View 6c39 on RCSB PDB site
Description: Apo crystal structure of wild-type S. aureus penicillin binding protein 4 (PBP4)
Class: hydrolase
Keywords: Hydrolase, Penicillin binding protein
Deposited on 2018-01-09, released 2018-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.6900000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine-type D-Ala-D-Ala carboxypeptidase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: HMPREF3211_00659
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c39a1, d6c39a2
  • Chain 'B':
    Compound: Serine-type D-Ala-D-Ala carboxypeptidase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: HMPREF3211_00659
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c39b1, d6c39b2
  • Heterogens: ZN, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c39A (A:)
    gshmyaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasm
    tklmtmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitv
    snssnaaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkyk
    dqertvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtd
    glktgssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqyk
    yvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygp
    ptvevhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c39A (A:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c39B (B:)
    gshmyaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasm
    tklmtmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitv
    snssnaaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkyk
    dqertvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtd
    glktgssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqyk
    yvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygp
    ptvevhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c39B (B:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq