PDB entry 6c2o

View 6c2o on RCSB PDB site
Description: Crystal structure of HCV NS3/4A protease variant Y56H in complex with danoprevir
Class: hydrolase/hydrolase inhibitor
Keywords: NS3/4a Protease, Hepatitis C virus, Drug Resistance, protease inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-01-08, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C1KIK8 (22-197)
      • expression tag (0-21)
      • engineered mutation (31-32)
      • engineered mutation (35-36)
      • engineered mutation (39)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (70)
      • engineered mutation (74)
      • engineered mutation (90)
      • engineered mutation (104)
      • engineered mutation (177)
    Domains in SCOPe 2.07: d6c2oa1, d6c2oa2
  • Heterogens: TSV, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c2oA (A:)
    hmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatq
    tflatsingvlwtvhhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgs
    sdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavstr
    gvakavdfipveslettm