PDB entry 6c2n

View 6c2n on RCSB PDB site
Description: Crystal structure of HCV NS3/4A double mutant variant Y56H/D168A in complex with danoprevir
Class: hydrolase
Keywords: NS3/4a Protease, Hepatitis C virus, Drug Resistance, protease inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex, HYDROLASE
Deposited on 2018-01-08, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ns4a cofactor-ns3 protein chimera
    Species: Hepatitis C virus subtype 1a [TaxId:31646]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8DG50 (10-20)
      • expression tag (2-9)
      • engineered mutation (11)
      • engineered mutation (18-19)
      • linker (21-22)
    • Uniprot A8DG50 (23-End)
      • engineered mutation (23)
      • engineered mutation (33-34)
      • engineered mutation (37-38)
      • engineered mutation (41)
      • engineered mutation (60)
      • engineered mutation (67)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (92)
      • engineered mutation (106)
      • engineered mutation (179)
      • engineered mutation (188)
    Domains in SCOPe 2.07: d6c2na1, d6c2na2
  • Heterogens: ZN, SO4, TSV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c2nA (A:)
    gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
    tqtflatsingvlwtvhhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
    gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavs
    trgvakavafipveslettmrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c2nA (A:)
    hmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatq
    tflatsingvlwtvhhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgs
    sdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavstr
    gvakavafipveslettm