PDB entry 6c2h

View 6c2h on RCSB PDB site
Description: Crystal Structures of Cystathionine beta-Synthase from Saccharomyces cerevisiae: the Structure of the Catalytic Core
Class: lyase
Keywords: CBS, synthase, PLP, LYASE
Deposited on 2018-01-08, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cystathionine beta-synthase
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYS4, STR4, YGR155W, G6667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c2ha_
  • Heterogens: ACT, PLP, CA, NA, CL, PEG, PGE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c2hA (A:)
    mgsshhhhhhssgdlvprgshmmtkseqqadsrhnvidlvgntplialkklpkalgikpq
    iyaklelynpggsikdriaksmveeaeasgrihpsrstlieptsgntgiglaligaikgy
    rtiitlpekmsnekvsvlkalgaeiirtptaaawdspeshigvakklekeipgavildqy
    nnmmnpeahyfgtgreiqrqledlnlfdnlravvagagtggtisgiskylkeqndkiqiv
    gadpfgsilaqpenlnktditdykvegigydfvpqvldrklidvwyktddkpsfkyarql
    isnegvlvggssgsaftavvkycedhpelteddvivaifpdsirsyltkfvddewlkknn
    lwdddvlarfdsskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c2hA (A:)
    seqqadsrhnvidlvgntplialkklpkalgikpqiyaklelynpggsikdriaksmvee
    aeasgrihpsrstlieptsgntgiglaligaikgyrtiitlpekmsnekvsvlkalgaei
    irtptaaawdspeshigvakklekeipgavildqynnmmnpeahyfgtgreiqrqledln
    lfdnlravvagagtggtisgiskylkeqndkiqivgadpfgsilaqpenlnktditdykv
    egigydfvpqvldrklidvwyktddkpsfkyarqlisnegvlvggssgsaftavvkyced
    hpelteddvivaifpdsirsyltkfvddewlkknnlwdddvlarf