PDB entry 6c2g

View 6c2g on RCSB PDB site
Description: Human triosephosphate isomerase mutant V231M
Class: isomerase
Keywords: isomerase
Deposited on 2018-01-08, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPI1, TPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60174
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6c2ga_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPI1, TPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60174
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6c2gb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPI1, TPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60174
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6c2gc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPI1, TPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60174
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6c2gd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c2gA (A:)
    mapsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpki
    avaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalae
    glgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpq
    qaqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflmggaslkpe
    fvdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c2gA (A:)
    rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
    qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflmggaslkpefvdi
    inak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c2gB (B:)
    mapsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpki
    avaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalae
    glgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpq
    qaqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflmggaslkpe
    fvdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c2gB (B:)
    rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
    qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflmggaslkpefvdi
    inak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c2gC (C:)
    mapsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpki
    avaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalae
    glgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpq
    qaqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflmggaslkpe
    fvdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c2gC (C:)
    rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
    qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaiggktatpqqaqev
    heklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflmggaslkpefvdii
    nak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c2gD (D:)
    mapsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpki
    avaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalae
    glgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpq
    qaqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflmggaslkpe
    fvdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c2gD (D:)
    rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
    qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqaqev
    heklrgwlksnvsdavaqstriiyggsvtgtckelsqpdvdgflmggaslkpefvdiina
    k