PDB entry 6c25

View 6c25 on RCSB PDB site
Description: Crystal structure of Adenylosuccinate synthetase from Legionella pneumophila Philadelphia 1 in complex with GDP
Class: ligase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2018-01-06, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate synthetase
    Species: Legionella pneumophila [TaxId:446]
    Gene: purA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c25a_
  • Heterogens: GDP, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c25A (A:)
    mahhhhhhmgknvvvlgtqwgdegkgkivdlltqdaqvvvryqgghnaghtlkingvktv
    lrlipsgmlrpnvtcyiangvvlspqallseikelegnginvrerlrislacplilpyhi
    aldkarethmgksaigttgrgigpayedkvarralrvgdlfhrdrfankltelldyhnfv
    ltqyfkqpavdlesllgeslqwaeelrpmvcdvsaclhehrkqgenilfegaqgvyldid
    hgtypyvtssntcvgsvingagfgpryidyvlgitkayttrvgggpfptellddvgkria
    ergqefgavtgrprrcgwfdavllkrsielnsisglcvtkldvldglevlriavaykdrd
    gnilsrpplaaddfndllpvyeelpgwqestadvtvmsdlpanaraylkrieeilgipid
    mlstgperdstitlrgpfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c25A (A:)
    mgknvvvlgtqwgdegkgkivdlltqdaqvvvryqgghnaghtlkitvlrlipsgmlrpn
    vtcyiangvvlspqallseikelegnginvrerlrislacplilpyhialdkarethrgi
    gpayedkvarralrvgdlfhrdrfankltelldyhnfvltqyfkqpavdlesllgeslqw
    aeelrpmvcdvsaclhehrkqgenilfegasvingagfgpryidyvlgitkayttrvggg
    pfptellddvgkriaergqefgavtgrprrcgwfdavllkrsielnsisglcvtkldvld
    glevlriavaykdrdgnilsrpplaaddfndllpvyeelpgwqestadvtvmsdlpanar
    aylkrieeilgipidmlstgperdstitlrgpfl