PDB entry 6c1x

View 6c1x on RCSB PDB site
Description: Crystal Structure of Ketosteroid Isomerase D40N/D103N mutant from Pseudomonas Putida (pKSI) bound to 3,4-dinitrophenol
Class: isomerase
Keywords: enzyme, isomerase
Deposited on 2018-01-05, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-End)
      • engineered mutation (39)
      • engineered mutation (102)
    Domains in SCOPe 2.08: d6c1xa_
  • Heterogens: MG, DNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6c1xA (A:)
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvinvmrfdehgriqtmqayw
sevnlsvrepq

    Sequence, based on observed residues (ATOM records): (download) 
    >6c1xA (A:)
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvinvmrfdehgriqtmqayw
sevnlsv