PDB entry 6c1j

View 6c1j on RCSB PDB site
Description: Crystal Structure of Ketosteroid Isomerase Y32F/Y57F/D40N mutant from Pseudomonas Putida (pKSI) bound to 3,4-dinitrophenol
Class: isomerase
Keywords: enzyme, isomerase
Deposited on 2018-01-04, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-End)
      • engineered mutation (31)
      • engineered mutation (39)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d6c1ja_
  • Heterogens: MG, CL, DNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c1jA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmfaddatvenpfgqppihgreqiaaffrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c1jA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmfaddatvenpfgqppihgreqiaaffrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsv