PDB entry 6c0u

View 6c0u on RCSB PDB site
Description: Crystal structure of cAMP-dependent protein kinase Calpha subunit bound with N46
Class: transferase/transferase inhibitor
Keywords: Serine/threonine protein kinase (EC 2.7.11.11), TRANSFERASE, transferase-transferase inhibitor complex
Deposited on 2018-01-02, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkaca, Pkaca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c0ua_
  • Heterogens: EE4, DMS, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c0uA (A:)
    gshmgnaaaakkgseqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgr
    vmlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnl
    ymvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidq
    qgyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyp
    pffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkw
    fattdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c0uA (A:)
    eqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhya
    mkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfs
    hlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakr
    vkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyeki
    vsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkv
    eapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef