PDB entry 6c0b

View 6c0b on RCSB PDB site
Description: Structural basis for recognition of frizzled proteins by Clostridium difficile toxin B
Class: toxin
Keywords: complex, TOXIN
Deposited on 2017-12-28, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin b
    Species: Clostridioides difficile [TaxId:1496]
    Gene: tcdB
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4NKV9 (2-521)
      • expression tag (1)
  • Chain 'B':
    Compound: Frizzled-2
    Species: Homo sapiens [TaxId:9606]
    Gene: FZD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c0bb_
  • Heterogens: MLI, NAG, PAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c0bB (B:)
    hhhhhhhhhsgggsgggiegrpsgslevlfqgppdhgfcqpisiplctdiaynqtimpnl
    lghtnqedaglevhqfyplvkvqcspelrfflcsmyapvctvleqaippcrsicerarqg
    cealmnkfgfqwperlrcehfprhgaeqicvgqnhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c0bB (B:)
    dhgfcqpisiplctdiaynqtimpnllghtnqedaglevhqfyplvkvqcspelrfflcs
    myapvctvleqaippcrsicerarqgcealmnkfgfqwperlrcehfprhgaeqicvgqn
    h