PDB entry 6c08

View 6c08 on RCSB PDB site
Description: Zebrafish SLC38A9 with arginine bound in the cytosol open state
Class: membrane protein
Keywords: transporter, conformational state, substrate binding, complex, MEMBRANE PROTEIN
Deposited on 2017-12-28, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antibody fab heavy chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6C08 (0-217)
• Chain 'B':
  Compound: antibody fab light chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6C08 (0-214)
  Domains in SCOPe 2.07: d6c08b1, d6c08b2
• Chain 'C':
  Compound: Sodium-coupled neutral amino acid transporter 9
  Species: Danio rerio [TaxId:7955]
  Gene: slc38a9, zgc:154088
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08BA4 (Start-478)
• Chain 'D':
  Compound: antibody fab heavy chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6C08 (0-217)
• Chain 'E':
  Compound: antibody fab light chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6C08 (0-214)
  Domains in SCOPe 2.07: d6c08e1, d6c08e2
• Chain 'F':
  Compound: Sodium-coupled neutral amino acid transporter 9
  Species: Danio rerio [TaxId:7955]
  Gene: slc38a9, zgc:154088
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08BA4 (Start-478)
• Heterogens: ARG

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6c08B (B:)
  dilmtqspsslsvvvgfyvtitsqasnnittyssfifwyqqkpgqapklliydsstlesg
  ipgrfsgsgsgrdfsltigpnqpadgatyedlqyngevrtfgggtkleikradaaptvsi
  fppsseqltsggaevvcflnnfypkninvawkidggerqngvlnswtdqdsadstysmss
  tltltkdeyerhasytceathqtstspivksfnrn
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6c08E (E:)
  dilmtqspsslsvvvgfyvtitsqasnnittyssfifwyqqkpgqapklliydsstlesg
  ipgrfsgsgsgrdfsltigpnqpadgatyedlqyngevrtfgggtkleikradaaptvsi
  fppsseqltsggaevvcflnnfypkninvawkidggerqngvlnswtdqdsadstysmss
  tltltkdeyerhasytceathqtstspivksfnrn
  

  
  
• Chain 'F':
  No sequence available.