PDB entry 6c08

View 6c08 on RCSB PDB site
Description: Zebrafish SLC38A9 with arginine bound in the cytosol open state
Class: membrane protein
Keywords: transporter, conformational state, substrate binding, complex, MEMBRANE PROTEIN
Deposited on 2017-12-28, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C08 (0-217)
    Domains in SCOPe 2.08: d6c08a_
  • Chain 'B':
    Compound: antibody fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C08 (0-214)
    Domains in SCOPe 2.08: d6c08b1, d6c08b2
  • Chain 'C':
    Compound: Sodium-coupled neutral amino acid transporter 9
    Species: Danio rerio [TaxId:7955]
    Gene: slc38a9, zgc:154088
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C08 (0-217)
    Domains in SCOPe 2.08: d6c08d_
  • Chain 'E':
    Compound: antibody fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C08 (0-214)
    Domains in SCOPe 2.08: d6c08e1, d6c08e2
  • Chain 'F':
    Compound: Sodium-coupled neutral amino acid transporter 9
    Species: Danio rerio [TaxId:7955]
    Gene: slc38a9, zgc:154088
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ARG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c08A (A:)
    qiqlvqsgpklskpggtdkisskasgysftdyvmnwvkagpgkglewngsintsngytty
    isafkgrgsfsvdssastaaqqlsvlkaaatavyfnarnfrgngamdywgqgtsvtvssa
    kttapsvyplevsxxxxtgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlasdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c08A (A:)
    qiqlvqsgpklskpggtdkisskasgysftdyvmnwvkagpgkglewngsintsngytty
    isafkgrgsfsvdssastaaqqlsvlkaaatavyfnarnfrgngamdywgqgtsvtvssa
    kttapsvyplevstgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlasdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c08B (B:)
    dilmtqspsslsvvvgfyvtitsqasnnittyssfifwyqqkpgqapklliydsstlesg
    ipgrfsgsgsgrdfsltigpnqpadgatyedlqyngevrtfgggtkleikradaaptvsi
    fppsseqltsggaevvcflnnfypkninvawkidggerqngvlnswtdqdsadstysmss
    tltltkdeyerhasytceathqtstspivksfnrn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c08D (D:)
    qiqlvqsgpklskpggtdkisskasgysftdyvmnwvkagpgkglewngsintsngytty
    isafkgrgsfsvdssastaaqqlsvlkaaatavyfnarnfrgngamdywgqgtsvtvssa
    kttapsvyplevsxxxxtgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlasdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c08D (D:)
    qiqlvqsgpklskpggtdkisskasgysftdyvmnwvkagpgkglewngsintsngytty
    isafkgrgsfsvdssastaaqqlsvlkaaatavyfnarnfrgngamdywgqgtsvtvssa
    kttapsvyplevstgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlasdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c08E (E:)
    dilmtqspsslsvvvgfyvtitsqasnnittyssfifwyqqkpgqapklliydsstlesg
    ipgrfsgsgsgrdfsltigpnqpadgatyedlqyngevrtfgggtkleikradaaptvsi
    fppsseqltsggaevvcflnnfypkninvawkidggerqngvlnswtdqdsadstysmss
    tltltkdeyerhasytceathqtstspivksfnrn
    

  • Chain 'F':
    No sequence available.