PDB entry 6c00

View 6c00 on RCSB PDB site
Description: Solution structure of translation initiation factor 1 from Clostridium difficile
Class: translation
Keywords: translation initiation factor, TRANSLATION
Deposited on 2017-12-26, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor IF-1
    Species: Peptoclostridium difficile [TaxId:1496]
    Gene: infA, CD630_00940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c00a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c00A (A:)
    masmakkdvielegtvsealpnamfkvklengheilchisgklrmnfirilegdkvnvel
    spydltrgritwrkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c00A (A:)
    makkdvielegtvsealpnamfkvklengheilchisgklrmnfirilegdkvnvelspy
    dltrgritwrkk