PDB entry 6bzs

View 6bzs on RCSB PDB site
Description: Human ABCC6 NBD1 in Apo state
Class: transport protein
Keywords: ABCC6, NBD1, Apo state, ATP-Binding Cassette transporter C6, nucleotide binding domain 1, TRANSPORT PROTEIN
Deposited on 2017-12-26, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multidrug resistance-associated protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ABCC6, ARA, MRP6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95255
      • engineered mutation (226)
    Domains in SCOPe 2.07: d6bzsa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bzsA (A:)
    saagkdcitihsatfawsqesppclhrinltvpqgcllavvgpvgagkssllsallgels
    kvegfvsiegavayvpqeawvqntsvvenvcfgqeldppwlervleacalqpdvdsfpeg
    ihtsigeqgmnlsggqkqrlslaravyrkaavyllddplaaldahvgqhvfnqvigpggl
    lqgttrilvthalhilpqadwiivlangaiaemgsyqellqrkgalvclldqarqpgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bzsA (A:)
    agkdcitihsatfawsqesppclhrinltvpqgcllavvgpvgagkssllsallgelskv
    egfvsiegavayvpqeawvqntsvvenvcfgqeldppwlervleacalqpdvdsfpegih
    tsigeqgmnlsggqkqrlslaravyrkaavyllddplaaldahvgqhvfnqvigpggllq
    gttrilvthalhilpqadwiivlangaiaemgsyqellqrkgalvclldq