PDB entry 6byv

View 6byv on RCSB PDB site
Description: Solution NMR structure of cysteine-rich calcium bound domains of very low density lipoprotein receptor
Class: structural protein
Keywords: 3 modules, calcium-bound domains, disulfide bonds, STRUCTURAL PROTEIN
Deposited on 2017-12-21, released 2018-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Very low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VLDLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6byva1, d6byva2, d6byva3
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6byvA (A:)
    ktcaesdfvcnngqcvpsrwkcdgdpdcedgsdespeqchmrtcriheiscgahstqcip
    vswrcdgendcdsgedeencgnitcspdeftcssgrcisrnfvcngqddcsdgsdeldca
    p