PDB entry 6byq

View 6byq on RCSB PDB site
Description: Crystal structure of Tyrosine-tRNA ligase from Helicobacter pylori G27
Class: ligase
Keywords: SSGCID, Structural Genomics, Tyrosine--tRNA ligase, Helicobacter pylori, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2017-12-21, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Helicobacter pylori (strain G27) [TaxId:563041]
    Gene: tyrS, HPG27_731
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Z7D7 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d6byqa1, d6byqa2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6byqA (A:)
    mahhhhhhmeqkisvalkeikrganeiigleyieklvrkyyetnerfivkagfdptapdl
    hlghtvliqklallqqygarvkfligdftamigdptgknetrkplnreqvlenaktyeeq
    iykildqkhtevcfnstwldalgakgmielcakfsvarmlerddfakrhkenrpisivef
    lypllqgydsvamgadielggndqkfnllvgrflqrayglnkeqsiitmpllegldgvqk
    mskslgnyvgiteepnamfgkimsvsddlmwryytllsaktleeiedlkhgilnqtlhpk
    avkedlageivaryydndqafkakeqfskvfsanllpeilsesdfdegvgildvlkqigf
    cpstsqarrdiqgggvkinqevikdesyrfvkgnyviqlgkkrfmklnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byqA (A:)
    hhhmeqkisvalkeikrganeiigleyieklvrkyyetnerfivkagfdptapdlhlght
    vliqklallqqygarvkfligdftamigtrkplnreqvlenaktyeeqiykildqkhtev
    cfnstwldalgakgmielcakfsvarmlerddfakrhkenrpisiveflypllqgydsva
    mgadielggndqkfnllvgrflqrayglnkeqsiitmpllegldgvqkmskslgnyvgit
    eepnamfgkimsvsddlmwryytllsaktleeiedlkhgilnqtlhpkavkedlageiva
    ryydndqafkake