PDB entry 6byn

View 6byn on RCSB PDB site
Description: Crystal structure of WDR5-Mb(S4) monobody complex
Class: transcription
Keywords: Beta-propeller, fibronectin, MLL1, inhibitor, TRANSCRIPTION
Deposited on 2017-12-21, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: WDR5-binding Monobody, Mb(S4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BYN (Start-97)
    Domains in SCOPe 2.07: d6bynm_
  • Chain 'W':
    Compound: WD repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR5, BIG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61964 (2-305)
      • expression tag (1)
    Domains in SCOPe 2.07: d6bynw1, d6bynw2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6bynM (M:)
    gsvssvptklevvaatptslliswdapavtvvhyvitygetggnspvqkfkvpgskstat
    isglkpgvdytitvyayqgggrwhpygyyspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bynM (M:)
    vssvptklevvaatptslliswdapavtvvhyvitygetggnspvqkfkvpgskstatis
    glkpgvdytitvyayqgggrwhpygyyspisinyrt
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >6bynW (W:)
    gtvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghkl
    gisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgs
    fdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclkt
    lidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsv
    tggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktik
    lwksdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bynW (W:)
    tvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklg
    isdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsf
    desvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktl
    idddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvt
    ggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktikl
    wksdc