PDB entry 6by2

View 6by2 on RCSB PDB site
Description: Closed and deep-inactivated conformation of KcsA-T75A mutant
Class: membrane protein
Keywords: KcsA, C-type inactivation, ion channel, potassium channel, MEMBRANE PROTEIN
Deposited on 2017-12-19, released 2018-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BY2 (0-218)
    Domains in SCOPe 2.08: d6by2a1, d6by2a2
  • Chain 'B':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BY2 (0-211)
    Domains in SCOPe 2.08: d6by2b1, d6by2b2
  • Chain 'C':
    Compound: pH-gated potassium channel KcsA
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: KCSA, SKC1, SCO7660, SC10F4.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A333 (0-94)
      • engineered mutation (53)
      • engineered mutation (68)
      • expression tag (95-102)
    Domains in SCOPe 2.08: d6by2c1, d6by2c2
  • Heterogens: F09, DGA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6by2A (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6by2B (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6by2C (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh