PDB entry 6bxa

View 6bxa on RCSB PDB site
Description: Crystal structure of N-terminal fragment of Zebrafish Toll-Like Receptor 5 (TLR5) with Lamprey Variable Lymphocyte Receptor 2 (VLR2) bound
Class: immune system
Keywords: VLR, LEUCINE-RICH REPEAT, antibody, IMMUNE SYSTEM
Deposited on 2017-12-18, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toll-like receptor 5b, Variable lymphocyte receptor B chimera
    Species: Eptatretus burgeri [TaxId:7764]
    Gene: VLRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8W3J5 (Start-372)
    • Uniprot Q4G1L2 (373-447)
      • expression tag (448)
  • Chain 'B':
    Compound: Toll-like receptor 5b, Variable lymphocyte receptor B chimera
    Species: Eptatretus burgeri [TaxId:7764]
    Gene: VLRB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Variable Lymphocyte Receptor 2
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BXA (Start-208)
    Domains in SCOPe 2.07: d6bxac_
  • Chain 'D':
    Compound: Variable Lymphocyte Receptor 2
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BXA (Start-208)
    Domains in SCOPe 2.07: d6bxad_
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bxaC (C:)
    gghhhhhhgsenlyfqgacpsqcscsgttvdcsgkslasvptgiptttqvlglssnqitk
    lepgvfdslvnlqilvlyqnqlttlpagvfdrlinlkelyfsnnqltslpagvfdkltql
    trlelqtnqlksiprgafdnlksltniylfnnpwdcecsdilylknwivqhasivnpdgh
    ggvdnvkcsgtntpvravteastspskcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bxaC (C:)
    acpsqcscsgttvdcsgkslasvptgiptttqvlglssnqitklepgvfdslvnlqilvl
    yqnqlttlpagvfdrlinlkelyfsnnqltslpagvfdkltqltrlelqtnqlksiprga
    fdnlksltniylfnnpwdcecsdilylknwivqhasivnpdghggvdnvkcsgtntpvra
    vteastspskcp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bxaD (D:)
    gghhhhhhgsenlyfqgacpsqcscsgttvdcsgkslasvptgiptttqvlglssnqitk
    lepgvfdslvnlqilvlyqnqlttlpagvfdrlinlkelyfsnnqltslpagvfdkltql
    trlelqtnqlksiprgafdnlksltniylfnnpwdcecsdilylknwivqhasivnpdgh
    ggvdnvkcsgtntpvravteastspskcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bxaD (D:)
    acpsqcscsgttvdcsgkslasvptgiptttqvlglssnqitklepgvfdslvnlqilvl
    yqnqlttlpagvfdrlinlkelyfsnnqltslpagvfdkltqltrlelqtnqlksiprga
    fdnlksltniylfnnpwdcecsdilylknwivqhasivnpdghggvdnvkcsgtntpvra
    vteastspskcp