PDB entry 6bx8

View 6bx8 on RCSB PDB site
Description: Human Mesotrypsin (PRSS3) Complexed with Tissue Factor Pathway Inhibitor Variant (TFPI1-KD1-K15R-I17C-I34C)
Class: hydrolase
Keywords: Hydrolase, Hydrolase Inhibitor
Deposited on 2017-12-18, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • conflict (107)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d6bx8a_
  • Chain 'B':
    Compound: tissue factor pathway inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: TFPI, LACI, TFPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10646 (12-End)
      • engineered mutation (26)
      • engineered mutation (28)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d6bx8b_
  • Chain 'C':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • conflict (107)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d6bx8c_
  • Chain 'D':
    Compound: tissue factor pathway inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: TFPI, LACI, TFPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10646
      • engineered mutation (26)
      • engineered mutation (28)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d6bx8d_
  • Chain 'E':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • conflict (107)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d6bx8e_
  • Chain 'F':
    Compound: tissue factor pathway inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: TFPI, LACI, TFPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10646
      • engineered mutation (26)
      • engineered mutation (28)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d6bx8f_
  • Chain 'G':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • conflict (107)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d6bx8g_
  • Chain 'H':
    Compound: tissue factor pathway inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: TFPI, LACI, TFPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10646 (12-End)
      • engineered mutation (26)
      • engineered mutation (28)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d6bx8h_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bx8A (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bx8B (B:)
    yvdykddddkefmhsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesl
    eeckkmctrdprhhhhhhan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bx8B (B:)
    mhsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesleeckkmc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bx8C (C:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bx8D (D:)
    yvdykddddkefmhsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesl
    eeckkmctrdprhhhhhhan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bx8D (D:)
    sfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesleeckkmc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bx8E (E:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bx8F (F:)
    yvdykddddkefmhsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesl
    eeckkmctrdprhhhhhhan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bx8F (F:)
    hsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesleeckkmc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bx8G (G:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6bx8H (H:)
    yvdykddddkefmhsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesl
    eeckkmctrdprhhhhhhan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bx8H (H:)
    mhsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesleeckkmc