PDB entry 6bx6

View 6bx6 on RCSB PDB site
Description: AMP-Activated protein kinase (AMPK) inhibition by SBI-0206965: alpha 2 kinase domain bound to SBI-0206965
Class: Transferase/Transferase Inhibitor
Keywords: Transferase, Serine/Threonine-protein kinase, Inhibitor, Transferase-Transferase Inhibitor complex
Deposited on 2017-12-17, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAA2, AMPK, AMPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bx6a_
  • Heterogens: EDJ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bx6A (A:)
    gpkhdgrvkighyvlgdtlgvgtfgkvkigehqltghkvavkilnrqkirsldvvgkikr
    eiqnlklfrhphiiklyqvistptdffmvmeyvsggelfdyickhgrveemearrlfqqi
    lsavdychrhmvvhrdlkpenvlldahmnakiadfglsnmmsdgeflrdscgspnyaape
    visgrlyagpevdiwscgvilyallcgtlpfddehvptlfkkirggvfyipeylnrsvat
    llmhmlqvdplkratikdirehewfkqdlpsylfpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bx6A (A:)
    ighyvlgdtlgvgtfgkvkigehqltghkvavkilnrqkirsldvvgkikreiqnlklfr
    hphiiklyqvistptdffmvmeyvsggelfdyickhgrveemearrlfqqilsavdychr
    hmvvhrdlkpenvlldahmnakiadfglsnyaapeyagpevdiwscgvilyallcgtlpf
    ddehvptlfkkirggvfyipeylnrsvatllmhmlqvdplkratikdirehewfkqdlps
    ylf