PDB entry 6bwk

View 6bwk on RCSB PDB site
Description: Crystal structure of the human MLKL pseudokinase domain T357E/S358E mutant
Class: transferase
Keywords: Pseudokinase, Necroptosis, TRANSFERASE
Deposited on 2017-12-15, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mixed lineage kinase domain-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Mlkl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bwka_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bwkA (A:)
    gamgsqeqikeikkeqlsgspwillrenevstlykgeyhrapvaikvfkklqagsiaivr
    qtfnkeiktmkkfespnilrifgicidetvtppqfsivmeycelgtlrelldrekdltlg
    krmvlvlgaarglyrlhhseapelhgkirssnflvtqgyqvklagfelrktqeemslgtt
    rektdrvkstaylspqeledvfyqydvkseiysfgivlweiatgdipfqgcnsekirklv
    avkrqqeplgedcpselreiidecrahdpsvrpsvdeilkklstfsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bwkA (A:)
    qikeikkeqlsgspwillrenevstlykgeyhrapvaikvfkklqagsiaivrqtfnkei
    ktmkkfespnilrifgicidetvtppqfsivmeycelgtlrelldrekdltlgkrmvlvl
    gaarglyrlhhseapelhgkirssnflvtqgyqvklagfetdrvkstaylspqeledvfy
    qydvkseiysfgivlweiatgdipfqgcnsekirklvavkrqqeplgedcpselreiide
    crahdpsvrpsvdeilkklstfs