PDB entry 6bvr

View 6bvr on RCSB PDB site
Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase I142A from Cupriavidus metallidurans
Class: oxidoreductase
Keywords: Holo structure, Dioxygenase, Mutant I142A, OXIDOREDUCTASE
Deposited on 2017-12-13, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Gene: nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1LCS4 (21-194)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d6bvra_
  • Heterogens: FE2, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bvrA (A:)
    mghhhhhhhhhhssghiegrhmltygapfnfprwidehahllkppvgnrqvwqdsdfivt
    vvggpnhrtdyhddpleeffyqlrgnaylnlwvdgrreradlkegdifllpphvrhspqr
    peagsaclvierqrpagmldgfewycdacghlvhrvevqlksavtdlpplfesfyasedk
    rrcphcgqvhpgraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bvrA (A:)
    mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
    qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
    fewycdacghlvhrvevqlksavtdlpplfesfyasedkrrcphcgqvhpgraa