PDB entry 6bvc

View 6bvc on RCSB PDB site
Description: Crystal structure of AAC(3)-Ia in complex with coenzyme A
Class: transferase
Keywords: aminoglycoside, antibiotic, resistance, GCN5 family N-acetyltransferase, GNAT, alpha/beta protein, coenzyme A, CoA, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, transferase
Deposited on 2017-12-12, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside-(3)-N-acetyltransferase
    Species: Serratia marcescens [TaxId:615]
    Gene: AACC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bvca_
  • Heterogens: COA, CL, PE3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6bvcA (A:)
mlrssndvtqqgsrpktklggssmgiirtcrlgpdqvksmraaldlfgrefgdvatysqh
qpdsdylgnllrsktfialaafdqeavvgalaayvlpkfeqprseiyiydlavsgehrrq
giatalinllkheanalgayviyvqadygddpavalytklgireevmhfdidpstat

    Sequence, based on observed residues (ATOM records): (download) 
    >6bvcA (A:)
mgiirtcrlgpdqvksmraaldlfgrefgdvatysqhqpdsdylgnllrsktfialaafd
qeavvgalaayvlpkfeqprseiyiydlavsgehrrqgiatalinllkheanalgayviy
vqadygddpavalytklgireevmhfdidpstat