PDB entry 6bv9

View 6bv9 on RCSB PDB site
Description: Structure of proteinaceous RNase P 1 (PRORP1) from A. thaliana after overnight soak with juglone
Class: hydrolase/hydrolase inhibitor
Keywords: metallonuclease, PRORP, ribonuclease, PIN, tRNA processing, RNAse P, NYN domain, PPR domain, chloroplasts, mitochondria, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-12-12, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinaceous RNase P 1, chloroplastic/mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PRORP1, At2g32230, F22D22.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bv9a1, d6bv9a2, d6bv9a3
  • Heterogens: JUG, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bv9A (A:)
    gaghmaspsenlsrkakkkaiqqspeallkqkldmcskkgdvlealrlydearrngvqls
    qyhynvllyvcslaeaatesspnpglsrgfdifkqmivdkvvpneatftngarlavakdd
    pemafdmvkqmkafgiqprlrsygpalfgfcrkgdadkayevdahmvesevvpeepelaa
    llkvsmdtknadkvyktlqrlrdlvrqvskstfdmieewfksevatktgvkkwdvkkird
    avvsggggwhgqgwlgtgkwnvkrtemdengvckcckeklvcidinpvetetfaasltrl
    acerevkanfnqfqewlerhgpfdavidganmglvnqrsfsffqlnntvqrcqqispskr
    lplvilhksrvnggpatypknrallekwknagalyatppgsnddwywlyaavsckcllvt
    ndemrdhlfqllgnsffprwkekhqvrisvtredglklnmpppysiviqesedgtwhvpm
    sveddlqtsrqwlcakrsktp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bv9A (A:)
    speallkqkldmcskkgdvlealrlydearrngvqlsqyhynvllyvcslaeaatesspn
    pglsrgfdifkqmivdkvvpneatftngarlavakddpemafdmvkqmkafgiqprlrsy
    gpalfgfcrkgdadkayevdahmvesevvpeepelaallkvsmdtknadkvyktlqrlrd
    lvrqvskstfdmieewfksevatktgvkkwdvkkirdavvsggggwhgqgwlgtgkwnvk
    rtemdengvckcckeklvcidinpvetetfaasltrlacerevkanfnqfqewlerhgpf
    davidganmglvnqrsfsffqlnntvqrcqqispskrlplvilhksrvnatypknralle
    kwknagalyatppgsnddwywlyaavsckcllvtndemrdhlfqllgnsffprwkekhqv
    risvtredglklnmpppysiviqesedgtwhvpmsveddlqtsrqwlcakrs