PDB entry 6bv2

View 6bv2 on RCSB PDB site
Description: Crystal structure of porcine aminopeptidase-N with Isoleucine
Class: hydrolase
Keywords: zinc aminopeptidase, hydrolase
Deposited on 2017-12-12, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (0-900)
      • conflict (44)
      • expression tag (901)
    Domains in SCOPe 2.07: d6bv2a1, d6bv2a2, d6bv2a3, d6bv2a4, d6bv2a5
  • Heterogens: NAG, ILE, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bv2A (A:)
    qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
    lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
    ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
    nmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpn
    aiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenal
    lfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaep
    twnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirml
    snfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlq
    mgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvs
    qaqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviyds
    fnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkq
    veplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpen
    npihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnryl
    gytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgv
    trrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfieh
    ss