PDB entry 6bub

View 6bub on RCSB PDB site
Description: Crystal structure of the PI3KC2alpha PX domain in space group P432
Class: transferase
Keywords: PX domain, lipid binding, phosphoinositide, PI3-kinase, Transferase
Deposited on 2017-12-09, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6buba_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bubA (A:)
    snadepilsfspktysfrqdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfr
    tfdefqelhnklsiifplwklpgfpnrmvlgrthikdvaakrkielnsylqslmnastdv
    aecdlvctffhpllrdekaegia
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bubA (A:)
    epilsfspktysfrqdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfde
    fqelhnklsiifplwklpgfpndvaakrkielnsylqslmnastdvaecdlvctffhpll
    rdek