PDB entry 6bty

View 6bty on RCSB PDB site
Description: Crystal structure of the PI3KC2alpha C2 domain in space group P41212
Class: transferase
Keywords: C2 domain, lipid binding, phosphoinositide, PI3-kinase, Transferase
Deposited on 2017-12-08, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6btya_
  • Chain 'B':
    Compound: Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00443 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6btyb1, d6btyb2
  • Heterogens: O4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6btyA (A:)
    snaiggavklsisyrngtlfimvmhikdlvtedgadpnpyvktyllpdnhktskrktkis
    rktrnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggvtlplkdfnlsketv
    kwyqltaatyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6btyA (A:)
    gavklsisyrngtlfimvmhikdlvtedgadpnpyvktyllpdnhktskrktkisrktrn
    ptfnemlvysgysketlrqrelqlsvlsaeslrenfflggvtlplkdfnlsketvkwyql
    ta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6btyB (B:)
    snaiggavklsisyrngtlfimvmhikdlvtedgadpnpyvktyllpdnhktskrktkis
    rktrnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggvtlplkdfnlsketv
    kwyqltaatyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6btyB (B:)
    snaiggavklsisyrngtlfimvmhikdlvtedgadpnpyvktyllpdnhktskrktkis
    rktrnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggvtlplkdfnlsketv
    kwyqltaa