PDB entry 6btg

View 6btg on RCSB PDB site
Description: Crystal structure of deoxyribose-phosphate aldolase bound with DHAP from Bacillus Thuringiensis
Class: lyase
Keywords: DHAP, 5-deoxyribose, radical SAM enzyme byproduct, LYASE
Deposited on 2017-12-06, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fuculose phosphate aldolase
    Species: BACILLUS THURINGIENSIS [TaxId:1428]
    Gene: BK775_23715, CCZ40_07290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6btga_
  • Heterogens: MN, 13P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6btgA (A:)
    mllqkereeivaygkkmissgltkgtggnisifnreqglvaispsgleyyetkpedvvil
    nldgeviegerkpsseldmhliyyrkredinalvhthspyaktiaslgwelpavsyliaf
    agpnvrcapyetfgtkqladaafegmidrravllanhgliagannikmaftvaeeiefca
    qiyyqtksigepkllpedemenlakkfegygqqylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6btgA (A:)
    mllqkereeivaygkkmissgltkgtggnisifnreqglvaispsgleyyetkpedvvil
    nldgeviegerkpsseldmhliyyrkredinalvhthspyaktiaslgwelpavsyliaf
    agpnvrcapyetfgtkqladaafegmidrravllanhgliagannikmaftvaeeiefca
    qiyyqtksigepkllpedemenlakkf