PDB entry 6bsk

View 6bsk on RCSB PDB site
Description: Human PIM1 kinase in complex with compound 12b
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: Kinase, PIM1, inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2017-12-03, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bska_
  • Heterogens: EDO, MVG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bskA (A:)
    ekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpme
    vvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffw
    qvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysp
    pewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirw
    clalrpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bskA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh