PDB entry 6bsd

View 6bsd on RCSB PDB site
Description: DDR1 bound to Dasatinib
Class: transferase/transferase inhibitor
Keywords: Kinase, Inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-12-02, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epithelial discoidin domain-containing receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bsda_
  • Heterogens: 1N1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bsdA (A:)
    mgpealssllllllvasgdadmkghfdpakcryalgmqdrtipdsdisassswsdstaar
    hsrlessdgdgawcpagsvfpkeeeylqvdlqrlhlvalvgtqgrhagglgkefsrsyrl
    rysrdgrrwmgwkdrwgqevisgnedpegvvlkdlgppmvarlvrfypradrvmsvclrv
    elygclwrdgllsytapvgqtmylseavylndstydghtvgglqygglgqladgvvgldd
    frksqelrvwpgydyvgwsnhsfssgyvemefefdrlrafqamqvhcnnmhtlgarlpgg
    vecrfrrgpamawegepmrhnlggnlgdpraravsvplggrvarflqcrflfagpwllfs
    eisfisdvvnnsspalggtfppapwwppgppptnfssleleprgqqpvakaegsptaili
    gclvaiillllliialmlwrlhwrrllskaerrvleeeltvhlsvpgdtilinnrpgpre
    pppyqeprprgnpphsapcvpngsaysgdymepekpgapllppppqnsvphyaeadivtl
    qgvtggntyavpalppgavgdgpprvdfprsrlrfkeklgegqfgevhlcevdspqdlvs
    ldfplnvrkghpllvavkilrpdatknarndflkevkimsrlkdpniirllgvcvqddpl
    cmitdymengdlnqflsahqledkaaegapgdgqaaqgptisypmllhvaaqiasgmryl
    atlnfvhrdlatrnclvgenftikiadfgmsrnlyagdyyrvqgravlpirwmawecilm
    gkfttasdvwafgvtlwevlmlcraqpfgqltdeqvienageffrdqgrqvylsrppacp
    qglyelmlrcwsreseqrppfsqlhrflaedalntv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bsdA (A:)
    dfprsrlrfkeklgegqfgevhlcevdspllvavkilrpdatknarndflkevkimsrlk
    dpniirllgvcvqddplcmitdymengdlnqflsahqledkagptisypmllhvaaqias
    gmrylatlnfvhrdlatrnclvgenftikiadfgrnlyagdyyrvqgravlpirwmawec
    ilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeqvienageffrdqgrqvylsrpp
    acpqglyelmlrcwsreseqrppfsqlhrflaedalnt