PDB entry 6bs0

View 6bs0 on RCSB PDB site
Description: JAK2 JH2 in complex with 63552444
Class: transferase/transferase inhibitor
Keywords: Pseudokinase Domain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-12-01, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674
      • engineered mutation (123)
      • engineered mutation (241)
      • engineered mutation (258)
    Domains in SCOPe 2.07: d6bs0a_
  • Heterogens: E4V, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bs0A (A:)
    vfhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesff
    eaasmmsklshkhlvlnygvcvcgdenilvqefvkfgsldtylkknkncinilwklevak
    qlaaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqer
    ipwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpap
    kaaelanlinncmdyepdhrpsfraiirdlnslftpdlvprgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bs0A (A:)
    fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffe
    aasmmsklshkhlvlnygvcvcgdenilvqefvkfgsldtylkknkncinilwklevakq
    laaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeri
    pwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapk
    aaelanlinncmdyepdhrpsfraiirdlnsl