PDB entry 6br5

View 6br5 on RCSB PDB site
Description: N2 neuraminidase in complex with a novel antiviral compound
Class: hydrolase/hydrolase inhibitor
Keywords: Complex, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-11-30, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:654811]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6br5a_
  • Heterogens: NAG, BMA, MAN, CA, GOL, GYG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6br5A (A:)
    eyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttlnn
    vhsnntvrdrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddknat
    asfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegki
    vhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsglv
    gdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtiseksrlgyetfkvieg
    wsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsns
    ivvfcgtsgtygtgswpdgadinlmpi