PDB entry 6bqo

View 6bqo on RCSB PDB site
Description: Structure of a dual topology fluoride channel with monobody S8
Class: membrane protein
Keywords: Fluoride channel, monobody, dual topology, MEMBRANE PROTEIN
Deposited on 2017-11-28, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoride ion transporter CrcB
    Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) [TaxId:257313]
    Gene: crcB, BP1217
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VYU0 (Start-127)
      • engineered mutation (28)
      • engineered mutation (93)
  • Chain 'B':
    Compound: Fluoride ion transporter CrcB
    Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) [TaxId:257313]
    Gene: crcB, BP1217
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VYU0 (0-127)
      • engineered mutation (28)
      • engineered mutation (93)
  • Chain 'C':
    Compound: Monobody S8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BQO (0-94)
    Domains in SCOPe 2.08: d6bqoc_
  • Heterogens: F, NA, OLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6bqoC (C:)
ssvptklevvaatptslliswdapavtvdhyvitygetgaywsyqeftvpgskstatisg
lkpgvdytitvyanpysdapiyysyhspisinyrt