PDB entry 6bql

View 6bql on RCSB PDB site
Description: Crystal Structure of the Human CAMKK2B in complex with TAE-226
Class: transferase
Keywords: transferase, protein kinase domain, Structural Genomics, Structural Genomics Consortium, SGC, Transferase Inhibitor Complex
Deposited on 2017-11-28, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK2, CAMKKB, KIAA0787
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RR4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d6bqla1, d6bqla2
  • Heterogens: BI9, EDO, CL, ACT, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bqlA (A:)
    smqlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqagfprrppprgtrp
    apggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhlymvfelvnqgpvmev
    ptlkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedghikiadfgvsnefk
    gsdallsntvgtpafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimcl
    hskiksqalefpdqpdiaedlkdlitrmldknpesrivvpeiklhpwvtrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bqlA (A:)
    smqlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqagfprrpiqprgpi
    eqvyqeiailkkldhpnvvklvevlddpnedhlymvfelvnqgpvmevptlkplsedqar
    fyfqdlikgieylhyqkiihrdikpsnllvgedghikiadfgvsnefkgsdallsntvgt
    pafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimclhskiksqalefp
    dqpdiaedlkdlitrmldknpesrivvpeiklhpwvtr