PDB entry 6bqd

View 6bqd on RCSB PDB site
Description: TAF1-BD2 bromodomain in complex with (E)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]pyridin-4-yl)-N,N-dimethylbenzamide
Class: gene regulation
Keywords: TAF1-BD2, Bromodomain, GENE REGULATION
Deposited on 2017-11-27, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF1, BA2R, CCG1, CCGS, TAF2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bqda_
  • Chain 'B':
    Compound: Transcription initiation factor TFIID subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF1, BA2R, CCG1, CCGS, TAF2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bqdb_
  • Heterogens: 69G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bqdA (A:)
    dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
    kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
    akeaaleeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bqdA (A:)
    dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
    kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
    akeaaleea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bqdB (B:)
    dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
    kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
    akeaaleeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bqdB (B:)
    ddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskhk
    yqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdicta
    keaaleeae