PDB entry 6bq0

View 6bq0 on RCSB PDB site
Description: Structure of human monoacylglycerol lipase bound to a covalent inhibitor
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Monoacylglycerol lipase, covalent inhibitor, SBDD, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2017-11-27, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bq0a_
  • Chain 'B':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bq0b_
  • Heterogens: E3A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bq0A (A:)
    masrgshhhhhhgagdrgpefpssmpeessprrtpqsipyqdlphlvnadgqylfcrywk
    ptgtpkalifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvf
    vrdvlqhvdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesa
    ttfkvlaakvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllna
    vsrveralpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelp
    evtnsvfheinmwvsqrtatagtaspplevdlqgdhglsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bq0A (A:)
    dlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarmlmgldllvfahdh
    vghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmggaiailtaaerpg
    hfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvlsrnktevdiynsd
    plicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskgayllmelaksq
    dktlkiyegayhvlhkelpevtnsvfheinmwvsqrtata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bq0B (B:)
    masrgshhhhhhgagdrgpefpssmpeessprrtpqsipyqdlphlvnadgqylfcrywk
    ptgtpkalifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvf
    vrdvlqhvdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesa
    ttfkvlaakvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllna
    vsrveralpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelp
    evtnsvfheinmwvsqrtatagtaspplevdlqgdhglsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bq0B (B:)
    sprrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarml
    mgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgg
    aiailtaaerpghfagmvlisplvlakvlaakvlnlvlpnlslgpidssvlsrnktevdi
    ynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskgayllmel
    aksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrtat