PDB entry 6bpd

View 6bpd on RCSB PDB site
Description: Plasmodium vivax invasion blocking monoclonal antibody 10B12
Class: immune system
Keywords: Plasmodium vivax, invasion, malaria, antibody, IMMUNE SYSTEM
Deposited on 2017-11-22, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoclonal antibody 10B12 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BPD
  • Chain 'B':
    Compound: Monoclonal antibody 10B12 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BPD
    Domains in SCOPe 2.07: d6bpdb1, d6bpdb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bpdB (B:)
    mmspaqflfllvlwiretngdvvmtqtpltlsvtigqpasmsckssqslldrdgktylnw
    ffwrpgqspkrliylvskldsgvpdrftgggsgtdftlkinrveaedlgiyycwqgthfp
    qtfgggtkldikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgser
    qngvlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpdB (B:)
    gdvvmtqtpltlsvtigqpasmsckssqslldrdgktylnwffwrliylvskldsgvpdr
    ftgggsgtdftlkinrveaedlgiyycwqgthfpqtfgggtkldikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr